sokrypton / sokrypton/ColabFold
MMseqs returns no hits.
Nobody has claimed this yet.
- Dominant language
- Jupyter Notebook
- Stars
- 2.9k
- Forks
- 747
- PR merge metrics
- No merged PRs in 30d
Description
The following sequence returns no hits when submitted to either af_mmseqs2 or af_advanced:
NVEPLNGQSEVTGMLDKDITLQWQITFLKGEMLQSHDIYLPNRTKIVSNQPPELTPVGKRMYGTRLVPVFDADAAVFKLTLKNVKFTDSSHNFTLVVAFERKDDFNRRTGVADINIVNVE
However, if I truncate it by one aa, I get 70 hits. This is with both af_mmseqs2 or af_advanced
NVEPLNGQSEVTGMLDKDITLQWQITFLKGEMLQSHDIYLPNRTKIVSNQPPELTPVGKRMYGTRLVPVFDADAAVFKLTLKNVKFTDSSHNFTLVVAFERKDDFNRRTGVADINIVNV
I am unable to tell if this is the same bug as reported in issue #49
Contributor guide
First steps
- Read the whole issue, then the project's contributing guide.
- Comment on the issue to say you are picking it up — it saves two people doing the same work.
- Fork the repository and make your change on a branch.
- Open a pull request that references the issue number.
Research direction
Reproduce the report by submitting the full sequence and its one-amino-acid truncation to both af_mmseqs2 and af_advanced. Compare the hit counts with the behavior described in issue #49, then trace the relevant entry point for these submission modes. Done means the full sequence's no-hit behavior is explained and the issue is either fixed or documented with a clear cause.
Written by the indexing model from the issue text.
Assessment
- Domain
- bioinformatics
- Issue type
- Bug
- Difficulty
- 4/5
- Estimated time
- 3-5 days
- Activity status
- Stale
- Clarity
- Needs clarification
- Newbie friendliness
- 28/100