Amber works in AlphaFold2_mmseqs2 but not in AlphaFold2_batch

When I try to run the predefined example sequence (PIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASK) with templates, one model and amber it works in AlphaFold2_mmseqs2, but fails in AlphaFold2_batch with the following error:

ValueError                                Traceback (most recent call last)

<ipython-input-3-a76dac23e0b1> in <module>()
    391                            Ls=[len(query_sequence)], crop_len=crop_len,
    392                            model_params=model_params, use_model=use_model,
--> 393                            do_relax=use_amber)
    394 
    395   # gather MSA info

<ipython-input-3-a76dac23e0b1> in predict_structure(prefix, feature_dict, Ls, crop_len, model_params, use_model, do_relax, random_seed)
    276                                               stiffness=10.0,exclude_residues=[],
    277                                               max_outer_iterations=20)      
--> 278         relaxed_pdb_str, _, _ = amber_relaxer.process(prot=unrelaxed_protein)
    279         relaxed_pdb_lines.append(relaxed_pdb_str)
    280 

/content/alphafold/relax/relax.py in process(self, prot)
     62         tolerance=self._tolerance, stiffness=self._stiffness,
     63         exclude_residues=self._exclude_residues,
---> 64         max_outer_iterations=self._max_outer_iterations)
     65     min_pos = out['pos']
     66     start_pos = out['posinit']

/content/alphafold/relax/amber_minimize.py in run_pipeline(prot, stiffness, max_outer_iterations, place_hydrogens_every_iteration, max_iterations, tolerance, restraint_set, max_attempts, checks, exclude_residues)
    459   # `protein.to_pdb` will strip any poorly-defined residues so we need to
    460   # perform this check before `clean_protein`.
--> 461   _check_residues_are_well_defined(prot)
    462   pdb_string = clean_protein(prot, checks=checks)
    463 

/content/alphafold/relax/amber_minimize.py in _check_residues_are_well_defined(prot)
    139   """Checks that all residues contain non-empty atom sets."""
    140   if (prot.atom_mask.sum(axis=-1) == 0).any():
--> 141     raise ValueError("Amber minimization can only be performed on proteins with"
    142                      " well-defined residues. This protein contains at least"
    143                      " one residue with no atoms.")

ValueError: Amber minimization can only be performed on proteins with well-defined residues. This protein contains at least one residue with no atoms.

Compare the AlphaFold2_mmseqs2 and AlphaFold2_batch execution paths, then reproduce the predefined sequence with templates, one model, and Amber. Start with relax/relax.py and relax/amber_minimize.py at the failing residue check. Done means the batch path completes Amber relaxation for this input without the well-defined-residue error.