sokrypton / sokrypton/ColabFold
notebook_utils failed import
Nobody has claimed this yet.
- Dominant language
- Jupyter Notebook
- Stars
- 2.9k
- Forks
- 747
- PR merge metrics
- No merged PRs in 30d
Description
Howdy,
I was running the deepmind version of AlphaFold and successfully did several runs before getting this failure message when trying to upload my next sequence.
ImportError Traceback (most recent call last)
in ()
4 #@markdown * If you enter multiple sequences, the multimer model will be used.
5
----> 6 from alphafold.notebooks import notebook_utils
7
8 sequence_1 = 'NAQESATRGATTIAQLIDADVLRTVELYDLTLQGLIAAAQRDDLKDVSPQIRHLALFDRSTTARFKGDILLLDKHGEVIADSSRVDPLPGNFADRDYFLAHAFNRDTGMFISRPFKPRCDCDDADQWRISFSRRISSNTGEFLGVAVASMKLDYFDQLFNSLDIGIDSTLNIINNDGILLAQKPYLQSDSIGKSFAARPNVVRILRDSSGNGSFNSISSMDHQQRLYTYSRVGNLPLTVIVALSSEEVFGA' #@param {type:"string"}
ImportError: cannot import name 'notebook_utils' from 'alphafold.notebooks' (unknown location)
Any idea what the deal is with this?
Thanks a bunch!
-Maria
Contributor guide
First steps
- Read the whole issue, then the project's contributing guide.
- Comment on the issue to say you are picking it up — it saves two people doing the same work.
- Fork the repository and make your change on a branch.
- Open a pull request that references the issue number.
Research direction
Start by reproducing the import in the notebook and inspect how the alphafold.notebooks package is made available in the reported environment. Done means the notebook can import notebook_utils and proceed to upload the sequence without this ImportError.
Written by the indexing model from the issue text.
Assessment
- Tech stack
- jupyter-notebook, python
- Domain
- bioinformatics, machine-learning
- Issue type
- Bug
- Difficulty
- 3/5
- Estimated time
- 1-2 days
- Activity status
- Stale
- Clarity
- Needs clarification
- Newbie friendliness
- 25/100