Error: Invalid sequence for "antibody"
Open
Nobody has claimed this yet.
- Dominant language
- Python
- Stars
- 265
- Forks
- 65
- PR merge metrics
- No merged PRs in 30d
Description
Error: Invalid sequence for "Antibody1": "QVQLVQSGGGVVQPGRSLRLSCKASGYTETRYTMHWVRQAPGKGLEWIGYINPSRGYTNYNOKVKDRFTISTDKSKSTAFLQMDSLRPEDTAVYYCARYYDDHYCSSASCFCLDYWGQGTPVTVSS"
I dont know how to deal with this issue , It would be much appreciated if this solves the problem,thanks guys!
Contributor guide
No contributing guide indexed for this repository
First steps
- Read the whole issue, then the project's contributing guide.
- Comment on the issue to say you are picking it up — it saves two people doing the same work.
- Fork the repository and make your change on a branch.
- Open a pull request that references the issue number.
Research direction
Start by reproducing the reported Antibody1 sequence in BioPhi and locating the sequence-validation path that emits “Invalid sequence.” Determine which character or validation rule rejects the sequence, then confirm the result with the same input and document a clear resolution.
Written by the indexing model from the issue text.
Assessment
- Tech stack
- python
- Domain
- bioinformatics
- Issue type
- Bug
- Difficulty
- 4/5
- Estimated time
- 3-5 days
- Activity status
- Stale
- Clarity
- Needs clarification
- Newbie friendliness
- 25/100